PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr028561.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 250aa    MW: 28603.7 Da    PI: 7.6456
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr028561.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-16550348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +WT+eEd+ll ++++q+G g W++ +   g++R++k+c++rw++yl
      Pbr028561.1  5 PWTKEEDQLLRKCIEQHGEGKWHRLPLLAGLNRCRKSCRLRWLNYL 50
                     7*******************************************97 PP

2Myb_DNA-binding49.41e-1556100147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++ +eE +l+++++++lG++ W+++a++++ gRt++++k++w+ +
      Pbr028561.1  56 RGNFEEEEVDLIIKLHRLLGNR-WSSVAARLP-GRTGNDVKNYWNCH 100
                      89********************.*********.***********977 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.875150IPR017930Myb domain
SMARTSM007173.9E-13252IPR001005SANT/Myb domain
SuperFamilySSF466894.77E-27497IPR009057Homeodomain-like
PfamPF002499.6E-15550IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.1E-22557IPR009057Homeodomain-like
CDDcd001671.17E-11550No hitNo description
PROSITE profilePS5129424.96451105IPR017930Myb domain
SMARTSM007174.7E-1555103IPR001005SANT/Myb domain
PfamPF002492.3E-145698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-2458105IPR009057Homeodomain-like
CDDcd001671.94E-1058101No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MGGIPWTKEE DQLLRKCIEQ HGEGKWHRLP LLAGLNRCRK SCRLRWLNYL RPNIKRGNFE  60
EEEVDLIIKL HRLLGNRWSS VAARLPGRTG NDVKNYWNCH LSKRLNAQQD HQSEYHINNK  120
HDAVRNINNG VKVIRSQASN SAGTSTSKRP SYAPTPHQPV IVFVQDEGSS TGPMPKLCNF  180
NGNGQNNNQI FENNNSTGIN ASHHPMDDDL PPFDQQVKEY HQGSDDGDQV NRKWEWDDSI  240
FADMDLWTD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-2251079110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT1592321e-126KT159232.1 Prunus persica R2R3-MYB transcription factor (MYB9) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009338015.10.0PREDICTED: myb-related protein 308-like
TrEMBLB5SU004e-89B5SU00_R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.15e-52myb domain protein 113